PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC926_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 345aa    MW: 39363.9 Da    PI: 7.8768
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC926_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox696e-2274133357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                +R+++t++ql++Leel+++ +r+psa+++++++++l    +++ ++V++WFqN++a+e++
  RrC926_p1  74 SRWNPTPDQLRALEELYQQgTRTPSADHIQQITSQLrrygKIEGKNVFYWFQNHKARERQ 133
                7*****************99**************************************97 PP

2Wus_type_Homeobox114.16.8e-3773135365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Ptp+Q++ Leely++G+rtP++++iq+it++L++yGkie+kNVfyWFQN+kaRerqk+
          RrC926_p1  73 SSRWNPTPDQLRALEELYQQGTRTPSADHIQQITSQLRRYGKIEGKNVFYWFQNHKARERQKR 135
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.3E-571138IPR001356Homeobox domain
SuperFamilySSF466892.13E-1273139IPR009057Homeodomain-like
PfamPF000461.2E-1974133IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-974133IPR009057Homeodomain-like
CDDcd000868.46E-675135No hitNo description
PROSITE profilePS5007111.04679134IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MWMMGYNEGG ADSFNGGRKL RPLIPRLSSC PTAAANTNAD HRFNMAVVTT MTAEQNKREL  60
MMLNSEPPPV MVSSRWNPTP DQLRALEELY QQGTRTPSAD HIQQITSQLR RYGKIEGKNV  120
FYWFQNHKAR ERQKRRRQME NGHDESVFTT TSLVSNQGFD KKDSKGYKVE QTKNWICSVG  180
CDTQPEKNHH HEQEPDSIAM VATKRNGRHG GDEIQSFPRR NAMWQMMQLP PGLYPSSQHH  240
HQLNLTTTVS SNMSTRNSTV SAAKDTVTFS PLFLRSRAAR NTETCDDNKD QEQHEDCLNG  300
ELDHQEQTLE LFPLRKEGFC SNGGDGGKEK EGGIHCFYEF LPLKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513940.0AY251394.1 Arabidopsis thaliana WOX1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009135563.10.0PREDICTED: WUSCHEL-related homeobox 1-like isoform X1
RefseqXP_013736498.10.0PREDICTED: WUSCHEL-related homeobox 1-like isoform X1
SwissprotQ6X7K00.0WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLA0A078IS840.0A0A078IS84_BRANA; BnaAnng11050D protein
TrEMBLM4CBW40.0M4CBW4_BRARP; Uncharacterized protein
STRINGBra001694.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73972741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.10.0WUSCHEL related homeobox 1